Invitrogen™ SI Polyclonal Antibody

Rabbit Polyclonal Antibody

Supplier:  Invitrogen™ PA595609

Catalog No. PIPA595609

Description

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: rat small intestine tissue. IHC: mouse small intestine tissue, rat small intestine tissue. Flow: CACO-2 cell. Store at -20°C for one year from date of receipt. After reconstitution, at 4°C for one month. It can also be aliquotted and stored frozen at -20°C for six months. Avoid repeated freeze-thaw cycles.

This gene encodes a sucrase-isomaltase enzyme that is expressed in the intestinal brush border. The encoded protein is synthesized as a precursor protein that is cleaved by pancreatic proteases into two enzymatic subunits sucrase and isomaltase. These two subunits heterodimerize to form the sucrose-isomaltase complex. This complex is essential for the digestion of dietary carbohydrates including starch, sucrose and isomaltose. Mutations in this gene are the cause of congenital sucrase-isomaltase deficiency.

Specifications

• Antigen: SI
• Classification: Polyclonal
• Conjugate: Unconjugated
• Gene: SI
• Gene Alias: 2010204N08Rik; alpha-glucosidase; c-sis; fd42f04; fd44a09; Isomaltase; maltase-glucoamylase (alpha-glucosidase); maltase-glucoamylase, intestinal; mgam; oligosaccharide alpha-1,6-glucosidase; pdgf protein; PDGF subunit B; PDGF-2; Pdgfb; platelet derived growth factor, B polypeptide; platelet-derived growth factor B chain; Platelet-derived growth factor beta polypeptide; platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog); platelet-derived growth factor subunit B; Platelet-derived growth factor, same as Sis (Simian sarcoma viral oncogene homologue, c-sis); pro-sucrase-isomaltase (EC 3.2.1.48-10); SI; SIS; Si-s; SUCIMAL; Sucrase; sucrase isomaltase (alpha-glucosidase); sucrase isomaltase, structural; sucrase-isomaltase; sucrase-isomaltase (alpha-glucosidase); sucrase-isomaltase, intestinal; wu:fd42f04; wu:fd44a09
• Host Species: Rabbit
• Purification Method: Affinity Chromatography
• Regulatory Status: RUO
• Gene ID (Entrez): 497756, 6476, 69983
• Content And Storage: -20°C
• Form: Lyophilized

• Applications: Flow Cytometry, Immunohistochemistry (Paraffin), Western Blot
• Concentration: 500 μg/mL
• Formulation: PBS with 4mg trehalose and no preservative
• Gene Accession No.: P14410, P23739
• Gene Symbols: SI, Sis
• Immunogen: A synthetic peptide corresponding to a sequence of human SI (FQLSRWNYKSLDVVKEVVRRNREAGIPFDTQVTDID).
• Quantity: 100 μg
• Primary or Secondary: Primary
• Target Species: Human, Mouse, Rat
• Product Type: Antibody
• Isotype: IgG