Siglec-2/CD22 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP325138

Catalog No. NB301314

Description

Siglec-2/CD22 Polyclonal antibody specifically detects Siglec-2/CD22 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: Siglec-2/CD22
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Alias: B-cell receptor CD22, BL-CAM, B-lymphocyte cell adhesion molecule, CD22 antigenMGC130020, CD22 molecule, sialic acid binding Ig-like lectin 2, Sialic acid-binding Ig-like lectin 2, SIGLEC-2, SIGLEC2FLJ22814, T-cell surface antigen Leu-14
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein Siglec-2/CD22 using the following amino acid sequence: SVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKE
• Quantity: 100 μL
• Research Discipline: Adaptive Immunity, B Cell Development and Differentiation Markers, DNA Repair, Immunology, Phospho Specific
• Gene ID (Entrez): 933
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified