Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

Siglec-2/CD22 Antibody, Novus Biologicals™
SDP

Catalog No. NB301314 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB301314 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB301314 Supplier Novus Biologicals Supplier No. NBP325138
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

Siglec-2/CD22 Polyclonal antibody specifically detects Siglec-2/CD22 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

Antigen Siglec-2/CD22
Applications Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias B-cell receptor CD22, BL-CAM, B-lymphocyte cell adhesion molecule, CD22 antigenMGC130020, CD22 molecule, sialic acid binding Ig-like lectin 2, Sialic acid-binding Ig-like lectin 2, SIGLEC-2, SIGLEC2FLJ22814, T-cell surface antigen Leu-14
Host Species Rabbit
Immunogen This antibody has been engineered to specifically recognize the recombinant protein Siglec-2/CD22 using the following amino acid sequence: SVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKE
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Adaptive Immunity, B Cell Development and Differentiation Markers, DNA Repair, Immunology, Phospho Specific
Primary or Secondary Primary
Gene ID (Entrez) 933
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.