Learn More
Description
Specifications
Specifications
| Antigen | Siglec-2/CD22 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500 |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | B-cell receptor CD22, BL-CAM, B-lymphocyte cell adhesion molecule, CD22 antigenMGC130020, CD22 molecule, sialic acid binding Ig-like lectin 2, Sialic acid-binding Ig-like lectin 2, SIGLEC-2, SIGLEC2FLJ22814, T-cell surface antigen Leu-14 |
| Host Species | Rabbit |
| Immunogen | This antibody has been engineered to specifically recognize the recombinant protein Siglec-2/CD22 using the following amino acid sequence: SVTRYEWKPHGAWEEPSLGVLKIQNVGWDNTTIACAACNSWCSWASPVALNVQYAPRDVRVRKIKPLSEIHSGNSVSLQCDFSSSHPKE |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
