Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SIGLECL12 Antibody, Novus Biologicals™
SDP

Catalog No. NBP15924320 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP15924320 20 μL
NBP159243 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP15924320 Supplier Novus Biologicals Supplier No. NBP15924320UL

Rabbit Polyclonal Antibody

SIGLECL12 Polyclonal specifically detects SIGLECL12 in Human samples. It is validated for Western Blot.

Specifications

Antigen SIGLECL12
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:100-1:2000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q96PQ1
Gene Alias FLJ38600, S2V, sialic acid binding Ig-like lectin 12, sialic acid-binding Ig-like lectin 12, Siglec-12, SIGLECL1Sialic acid-binding Ig-like lectin-like 1, SIGLEC-like 1, Siglec-XII, SLGSiglec-L1
Gene Symbols SIGLEC12
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SIGLEC12(sialic acid binding Ig-like lectin 12) The peptide sequence was selected from the N terminal of SIGLEC12. Peptide sequence LCVSVLCSFSYPQNGWTASDPVHGYWFRAGDHVSRNIPVATNNPARAVQE.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 89858
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.