Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SIPA1L2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SIPA1L2 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
SIPA1L2 Polyclonal specifically detects SIPA1L2 in Human samples. It is validated for Western Blot.Specifications
SIPA1L2 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Human | |
FLJ23632, signal-induced proliferation-associated 1 like 2, signal-induced proliferation-associated 1-like protein 2, SIPA1-like protein 2, SPA-1-like 2, SPAL2 | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Human SIPA1L2 (NP_065859). Peptide sequence LRQLQTDLRKEKQDKAVLQAEVQHLRQDNMRLQEESQTATAQLRKFTEWF | |
Affinity purified |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS buffer, 2% sucrose | |
57568 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title