Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SIRP alpha/CD172a Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP258429
Description
SIRP alpha/CD172a Polyclonal specifically detects SIRP alpha/CD172a in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
SIRP alpha/CD172a | |
Polyclonal | |
Immunohistochemistry-Paraffin 1:50 - 1:200 | |
Bit, BITbrain-immunoglobulin-like molecule with tyrosine-based activation motifs, Brain Ig-like molecule with tyrosine-based activation motifs, CD172 antigen-like family member A, CD172a, CD172a antigen, Inhibitory receptor SHPS-1, Macrophage fusion receptor, MFRtyrosine phosphatase SHP substrate 1, MYD1, MYD-1, MyD-1 antigen, P84, protein tyrosine phosphatase, non-receptor type substrate 1, PTPNS1, SHP substrate 1, SHPS-1, SHPS1CD172A, signal-regulatory protein alpha, Signal-regulatory protein alpha-1, Signal-regulatory protein alpha-2, Signal-regulatory protein alpha-3, SIRPalpha, SIRP-ALPHA-1, Sirp-alpha-2, SIRPalpha2, Sirp-alpha-3, SIRPtyrosine-protein phosphatase non-receptor type substrate 1 | |
Rabbit | |
Affinity Purified | |
RUO | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
SIRPA | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NNHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK | |
100 μL | |
GPCR, Protein Phosphatase, Signal Transduction | |
140885 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction