SIRT6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25622025UL

Catalog No. NB394590

Description

SIRT6 Polyclonal specifically detects SIRT6 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: SIRT6
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: EC 3.5.1.-, NAD-dependent deacetylase sirtuin-6, SIR2L6sir2-related protein type 6, SIR2-like protein 6, sirtuin (silent mating type information regulation 2 homolog) 6 (S. cerevisiae), sirtuin (silent mating type information regulation 2, S. cerevisiae, homolog) 6, sirtuin 6, sirtuin type 6
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: SIRT6
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DRDLALADEASRNADLSITLGTSLQIRPSGNLPLATKRRGGRLVIVNLQPTKHDRHADLRIHGYVDEVMTRLMKHL
• Quantity: 25 μL
• Research Discipline: Cancer, Chromatin Modifiers, Chromatin Research, DNA Repair, Epigenetics, Histone Deacetylases, Signal Transduction
• Gene ID (Entrez): 51548
• Target Species: Human
• Isotype: IgG

For Research Use Only