Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SIX3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25724925UL
Description
SIX3 Polyclonal specifically detects SIX3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
Six3 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
holoprosencephaly 2, alobar or semilobar, homeobox protein SIX3, HPE2, Sine oculis homeobox homolog 3, sine oculis homeobox homolog 3 (Drosophila), SIX homeobox 3 | |
Rabbit | |
Affinity Purified | |
RUO | |
6496 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide | |
SIX3 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KNRLQHQAIGPSGMRSLAEPGCPTHGSAESPSTAASPTTSVSSLTERADTGTSILSVTSSDS | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction