Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SKIV2L2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen	SKIV2L2
Dilution	Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NB432411 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP18499525UL	25ul	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NBP184995 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP184995	0.1 mL	Each for $610.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

SKIV2L2 Polyclonal specifically detects SKIV2L2 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	SKIV2L2
Applications	Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias	ATP-dependent helicase SKIV2L2, Dob1, EC 3.6.1, EC 3.6.4.13, fSAP118, KIAA0052functional spliceosome-associated protein 118, MGC142069, Mtr4superkiller viralicidic activity 2-like 2, superkiller viralicidic activity 2-like 2 (S. cerevisiae)
Gene Symbols	MTREX
Isotype	IgG
Purification Method	Affinity Purified
Test Specificity	Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Dilution	Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human, Mouse, Rat
Gene Accession No.	P42285
Gene ID (Entrez)	23517
Immunogen	This antibody was developed against Recombinant Protein corresponding to amino acids:LVVDENGDFREDNFNTAMQVLRDAGDLAKGDQKGRKGGTKGPSNVFKIVKMIMERNFQPVIIFSFSKKDCEAYALQMTK
Primary or Secondary	Primary
Content And Storage	Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Molecular Weight of Antigen	118 kDa

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

SKIV2L2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents