Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SKOR2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

$382.00 - $636.50

Specifications

Antigen	SKOR2
Dilution	Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:500 - 1:1000
Applications	Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated

View More Specs

Products 2

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP214565 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP214565	0.1 mL	Each for $636.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

NB437818 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP21456525UL	25 μL	Each for $382.00	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

SKOR2 Polyclonal specifically detects SKOR2 in Human, Mouse samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

Antigen	SKOR2
Applications	Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Regulatory Status	RUO
Formulation	PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez)	652991
Immunogen	This antibody was developed against a recombinant protein corresponding to the amino acids: MASSPLPGPNDILLASPSSAFQPDTLSQPRPGHANLKPNQVGQVILYGIPIVS
Primary or Secondary	Primary
Test Specificity	Specificity of human SKOR2 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

Dilution	Immunohistochemistry 1:500 - 1:1000, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:500 - 1:1000
Classification	Polyclonal
Host Species	Rabbit
Target Species	Human, Mouse
Gene Alias	CORL2, FUSSEL18, SKOR2 SKI family transcriptional corepressor 2
Gene Symbols	SKOR2
Isotype	IgG
Purification Method	Affinity Purified

For Research Use Only

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

SKOR2 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents