Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLA2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SLA2 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SLA2 Polyclonal specifically detects SLA2 in Human samples. It is validated for Western Blot.Specifications
SLA2 | |
Polyclonal | |
Rabbit | |
NP_115590 | |
84174 | |
Synthetic peptide directed towards the middle region of human SLA2The immunogen for this antibody is SLA2. Peptide sequence WLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGSYSLSVRLSRPASWD. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
C20orf156, FLJ21992, Modulator of antigen receptor signaling, SLAP-2MARS, SLAP2MGC49845, Src-like adapter protein 2, Src-like adapter protein-2, src-like-adapter 2, Src-like-adaptor 2 | |
SLA2 | |
IgG | |
28 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title