Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLA2 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | SLA2 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179830
|
Novus Biologicals
NBP179830 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
SLA2 Polyclonal specifically detects SLA2 in Human samples. It is validated for Western Blot.Specifications
| SLA2 | |
| Polyclonal | |
| Rabbit | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| C20orf156, FLJ21992, Modulator of antigen receptor signaling, SLAP-2MARS, SLAP2MGC49845, Src-like adapter protein 2, Src-like adapter protein-2, src-like-adapter 2, Src-like-adaptor 2 | |
| SLA2 | |
| IgG | |
| Affinity Purified | |
| 28 kDa |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_115590 | |
| 84174 | |
| Synthetic peptide directed towards the middle region of human SLA2The immunogen for this antibody is SLA2. Peptide sequence WLYEGLSREKAEELLLLPGNPGGAFLIRESQTRRGSYSLSVRLSRPASWD. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title