Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. PIPA580003

Invitrogen™ SLC12A1 Polyclonal Antibody
GREENER_CHOICE

Catalog No. PIPA580003
Change view
Click to view available options
Quantity:
100 μg
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
PIPA580003 100 μg
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. PIPA580003 Supplier Invitrogen™ Supplier No. PA580003
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

Reconstitute with 0.2 mL of distilled water to yield a concentration of 500 μg/mL. Positive Control - WB: monkey kidney tissue, rat kidney tissue, mouse kidney tissue. IHC: human renal cancer tissue, mouse kidney tissue, rat kidney tissue.

The sodium-potassium-chloride cotransporter isoform 2 is kidney-specific and is found on the apical membrane of the thick ascending limb of Henle's loop and the macula densa. It accounts for most of the NaCl resorption with the stoichiometry of 1Na:1K:2Cl and is sensitive to such diuretics as furosemide and bumetanide. Some Bartter-like syndromes result from defects in this gene.
TRUSTED_SUSTAINABILITY

Specifications

Antigen SLC12A1
Applications Immunohistochemistry (Paraffin), Western Blot
Classification Polyclonal
Concentration 500 μg/mL
Conjugate Unconjugated
Formulation PBS with 4mg trehalose and no preservative
Gene SLC12A1
Gene Accession No. P55014, P55016, Q13621
Gene Alias AI788571; apical Na(2Cl)K cotransporter; BSC1; bumetanide-sensitive cotransporter type 1; bumetanide-sensitive Na-K-Cl cotransport protein splice isoform A; bumetanide-sensitive Na-K-Cl cotransport protein splice isoform B; bumetanide-sensitive Na-K-Cl cotransport protein splice isoform F; bumetanide-sensitive sodium-(potassium)-chloride cotransporter 2; D630042G03Rik; Kidney-specific Na-K-Cl symporter; mBSC1; MGC48843; Na-K-2Cl cotransporter; NKCC2; NKCC2A variant A; SLC12A1; solute carrier family 12 (sodium/potassium/chloride transporter), member 1; solute carrier family 12 (sodium/potassium/chloride transporters), member 1; solute carrier family 12 member 1; Solute carrier family 12 member 1 (bumetanide-sensitive sodium-[potassium]-chloride cotransporter); solute carrier family 12, member 1; Solute carrier family 12, member 1 (bumetanide-sensitive sodium-[potassium]-chloride cotransporter); urehr3
Gene Symbols SLC12A1
Host Species Rabbit
Immunogen A synthetic peptide corresponding to a sequence at the N-terminus of human SLC12A1 (52-83aa DEAQKRLRISFRPGNQECYDNFLQSGETAKTD).
Purification Method Antigen affinity chromatography
Quantity 100 μg
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 20495, 25065, 6557
Target Species Human, Mouse, Rat, Monkey
Content And Storage -20°C
Product Type Antibody
Form Lyophilized
Isotype IgG
Show More Show Less

Safety and Handling

WARNING: Cancer - www.P65Warnings.ca.gov
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.