Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC14A1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$343.50 - $573.00
Specifications
Antigen | SLC14A1 |
---|---|
Dilution | Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml |
Applications | Immunofluorescence |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
SLC14A1 Polyclonal antibody specifically detects SLC14A1 in Human samples. It is validated for ImmunofluorescenceSpecifications
SLC14A1 | |
Immunofluorescence | |
Unconjugated | |
Rabbit | |
Human | |
FLJ33745, HsT1341, HUT11, JKFLJ41687, RACH1, solute carrier family 14 (urea transporter), member 1 (Kidd blood group), Solute carrier family 14 member 1, truncated urea transporter, urea transporter 1, urea transporter JK glycoprotein, Urea transporter, erythrocyte, urea transporter-B1, UT1UT-B1, UTEblood group Kidd urea transporter | |
This antibody was developed against Recombinant Protein corresponding to amino acids: MNGRSLIGGAGDARHGPVWKDPFGTKAGDAARRGIARLSLALADGSQEQE | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
PBS, pH 7.2, 40% glycerol | |
6563 | |
IgG | |
Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title