SLC16A6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159881

Catalog No. NBP159881

Description

SLC16A6 Polyclonal specifically detects SLC16A6 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SLC16A6
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: MCT6MCT 6, MCT7MCT 7, Monocarboxylate transporter 6, monocarboxylate transporter 7, solute carrier family 16 (monocarboxylic acid transporters), member 6, Solute carrier family 16 member 6, solute carrier family 16, member 6 (monocarboxylic acid transporter 7)
• Host Species: Rabbit
• Molecular Weight of Antigen: 57 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Equine: 100%; Human: 100%; Mouse: 92%; Canine: 85%; Rat: 85%; Bovine: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: O15403
• Gene Symbols: SLC16A6
• Immunogen: Synthetic peptides corresponding to SLC16A6(solute carrier family 16, member 6 (monocarboxylic acid transporter 7)) The peptide sequence was selected from the middle region of SLC16A6. Peptide sequence ILKEKSFICYALFGLFATLGFFAPSLYIIPLGISLGIDQDRAAFLLSTMA The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 9120
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only