Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC1A4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP276528
Description
SLC1A4 Polyclonal specifically detects SLC1A4 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
SLC1A4 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1 - 4 μ/mL | |
Alanine/serine/cysteine/threonine transporter 1, ASCT1, ASCT1 ASCT-1, neutral amino acid transporter A, SATTglutamate/neutral amino acid transporter, solute carrier family 1 (glutamate/neutral amino acid transporter), member 4, Solute carrier family 1 member 4 | |
Rabbit | |
100 μL | |
6509 | |
Human | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS, pH 7.2, containing 40% glycerol with 0.02% sodium azide | |
SLC1A4 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: KPGSGAQTLQSSDLGLEDSGPPPVPKETVDSFLDLA | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction