Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC20A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP325139
Description
SLC20A1 Polyclonal antibody specifically detects SLC20A1 in Human samples. It is validated for Immunocytochemistry/ ImmunofluorescenceSpecifications
SLC20A1 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
FLJ41426, Gibbon ape leukemia virus receptor 1, Glvr-1, GLVR1DKFZp686J2397, Leukemia virus receptor 1 homolog, Phosphate transporter 1, PiT-1PIT1, sodium-dependent phosphate transporter 1, solute carrier family 20 (phosphate transporter), member 1, Solute carrier family 20 member 1 | |
This antibody has been engineered to specifically recognize the recombinant protein SLC20A1 using the following amino acid sequence: YTSYCNAVSDLHSASEIDMSVKAEMGLGDRKGSNGSLEEWYDQDKPEVS | |
100 μL | |
Primary | |
Human | |
Purified |
Immunocytochemistry | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
6574 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction