SLC22A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159464

Catalog No. NBP159464

Description

SLC22A1 Polyclonal specifically detects SLC22A1 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SLC22A1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: hOCT1, oct1_cds, OCT1solute carrier family 22 member 1, Organic cation transporter 1, solute carrier family 22 (organic cation transporter), member 1
• Host Species: Rabbit
• Molecular Weight of Antigen: 61 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 4-8 ug/ml
• Gene Accession No.: Q9NQD4
• Gene Symbols: SLC22A1
• Immunogen: Synthetic peptides corresponding to SLC22A1(solute carrier family 22 (organic cation transporter), member 1) The peptide sequence was selected from the N terminal of SLC22A1 (NP_003048). Peptide sequence LSCVDPLASLATNRSHLPLGPCQDGWVYDTPGSSIVTEFNLVCADSWKLD The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6580
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Form: Purified

For Research Use Only