SLC22A17 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP188554

Catalog No. NBP188554

Description

SLC22A17 Polyclonal specifically detects SLC22A17 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SLC22A17
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
• Gene Alias: 24p3R, BOCTNGALR3, BOIThBOIT, Brain-type organic cation transporter, Lipocalin-2 receptor, Neutrophil gelatinase-associated lipocalin receptor, NgalR, NGALR2, NGALRNGAL receptor, potent brain type organic ion transporter, solute carrier family 22 (organic cation transporter), member 17, solute carrier family 22 member 17,24p3 receptor, solute carrier family 22, member 17
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 51310
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SLC22A17
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:RWLIVKRQIEEAQSVLRILAERNRPHGQMLGEEAQEALQDLENTCPLPATSSFSFASLLN
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only