Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC22A2/OCT2 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$343.50 - $573.00
Specifications
Antigen | SLC22A2/OCT2 |
---|---|
Dilution | Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 |
Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
SLC22A2/OCT2 Polyclonal antibody specifically detects SLC22A2/OCT2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)Specifications
SLC22A2/OCT2 | |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
Rabbit | |
Human | |
hOCT2, MGC32628, OCT2Organic cation transporter 2, solute carrier family 22 (organic cation transporter), member 2, solute carrier family 22 member 2 | |
This antibody was developed against Recombinant Protein corresponding to amino acids: ESPRWLISQNKNAEAMRIIKHIAKKNGKSLPASLQRLRLEEETGKKLNPSFLDLVRTPQIR | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500 | |
Polyclonal | |
Purified | |
RUO | |
PBS, pH 7.2, 40% glycerol | |
6582 | |
IgG | |
Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title