SLC22A7 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP169696

Catalog No. NBP169696

Description

SLC22A7 Polyclonal specifically detects SLC22A7 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SLC22A7
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: hOAT2, liver-specific transporter, NLTMGC45202, Novel liver transporter, OAT2MGC24091, Organic anion transporter 2, solute carrier family 22 (organic anion transporter), member 7, solute carrier family 22 member 7
• Host Species: Rabbit
• Molecular Weight of Antigen: 60 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9Y694-2
• Gene Symbols: SLC22A7
• Immunogen: Synthetic peptides corresponding to SLC22A7(solute carrier family 22 (organic anion transporter), member 7) The peptide sequence was selected from the N terminal of SLC22A7. Peptide sequence EPDGTLSSCLRFAYPQALPNTTLGEERQSRGELEDEPATVPCSQGWEYDH The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10864
• Target Species: Human
• Isotype: IgG

For Research Use Only