Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SLC25A11 Antibody, Novus Biologicals™

SLC25A11 Antibody, Novus Biologicals™
SDP

Catalog No. NBP159597 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159597 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP159597 Supplier Novus Biologicals Supplier No. NBP159597
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

SLC25A11 Polyclonal specifically detects SLC25A11 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen SLC25A11
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q02978
Gene Alias OGCmitochondrial 2-oxoglutarate/malate carrier protein, OGCP, SLC20A4solute carrier family 20 (oxoglutarate carrier), member 4, solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member11, Solute carrier family 25 member 11
Gene Symbols SLC25A11
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SLC25A11(solute carrier family 25 (mitochondrial carrier; oxoglutarate carrier), member 11) The peptide sequence was selected from the C terminal of SLC25A11. Peptide sequence DGKPEYKNGLDVLFKVVRYEGFFSLWKGFTPYYARLGPHTVLTFIFLEQM The peptide sequence for this immunogen was taken from within the described region.
Molecular Weight of Antigen 34 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8402
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep, Zebrafish
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.