SLC25A12 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP238249

Catalog No. NBP238249

Description

SLC25A12 Polyclonal specifically detects SLC25A12 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SLC25A12
• Classification: Polyclonal
• Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
• Gene Accession No.: O75746
• Gene Symbols: SLC25A12
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MAVKVQTTKRGDPHELRNIFLQYASTEVDGERYMTPEDFVQRYLGLYNDPNSNPKIVQLLAGVADQTK
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: AGC1, araceli hiperlarga, ARALAR, ARALAR1, calcium binding mitochondrial carrier superfamily member Aralar1, calcium-binding mitochondrial carrier protein Aralar1, Mitochondrial aspartate glutamate carrier 1, solute carrier family 25 (mitochondrial carrier, Aralar), member 12, Solute carrier family 25 member 12
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 8604
• Target Species: Human
• Isotype: IgG