Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC25A12 Antibody, Novus Biologicals™
SDP

Catalog No. NBP238249 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
25 μL
0.1 mL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP238249 0.1 mL
NB396913 25 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP238249 Supplier Novus Biologicals Supplier No. NBP238249
Only null left
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

SLC25A12 Polyclonal specifically detects SLC25A12 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen SLC25A12
Applications Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 0.4 ug/ml, Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Formulation PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Accession No. O75746
Gene Alias AGC1, araceli hiperlarga, ARALAR, ARALAR1, calcium binding mitochondrial carrier superfamily member Aralar1, calcium-binding mitochondrial carrier protein Aralar1, Mitochondrial aspartate glutamate carrier 1, solute carrier family 25 (mitochondrial carrier, Aralar), member 12, Solute carrier family 25 member 12
Gene Symbols SLC25A12
Host Species Rabbit
Immunogen This antibody was developed against a recombinant protein corresponding to amino acids: MAVKVQTTKRGDPHELRNIFLQYASTEVDGERYMTPEDFVQRYLGLYNDPNSNPKIVQLLAGVADQTK
Purification Method Affinity Purified
Quantity 0.1 mL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 8604
Test Specificity Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.