Novus Biologicals™ SLC25A23 Recombinant Protein Antigen

Catalog No.	Quantity
NBP258927PE	100μL

Catalog No. NBP258927PE Supplier Novus Biologicals™ Supplier No. NBP258927PEP

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human SLC25A23. Source: E.coli Amino Acid Sequence: ELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLDLEEFSRYLQEREQRLLLMFHSLDRNQDGHIDVSEIQQSFRALGISISLEQAEKILHSMDRDGTMTIDWQEWRDHFLLHSL The SLC25A23 Recombinant Protein Antigen is derived from E. coli. The SLC25A23 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 79085
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: SLC25A23 Recombinant Protein Antigen
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
• Formulation: PBS and 1M Urea, pH 7.4.
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: APC2FLJ30339, calcium-binding mitochondrial carrier protein SCaMC-3, MCSC2, MGC2615, Mitochondrial ATP-Mg/Pi carrier protein 2, Mitochondrial Ca(2+)-dependent solute carrier protein 2, mitochondrial Ca2+-dependent solute carrier protein 2, SCaMC-3, SCAMC3
• Gene Symbol: SLC25A23
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100μL
• Regulatory Status: RUO
• Source: E.coli
• Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51066. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml

For Research Use Only.