SLC25A25 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP18288625UL

Catalog No. NB407003

Description

SLC25A25 Polyclonal specifically detects SLC25A25 in Human, Mouse, Rat samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SLC25A25
• Classification: Polyclonal
• Dilution: Western Blot 0.04 - 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20-1:50
• Gene Alias: APC3, calcium-binding mitochondrial carrier protein SCaMC-2, KIAA1896RP11-395P17.4, MCSC, MCSC3, MGC105138, MGC119514, MGC119515, MGC119516, MGC119517, Mitochondrial ATP-Mg/Pi carrier protein 3, Mitochondrial Ca(2+)-dependent solute carrier protein 3, mitochondrial Ca2+-dependent solute carrier, PCSCL, SCAMC2, SCAMC-2, short calcium-binding mitochondrial carrier 2, small calcium-binding mitochondrial carrier 2, Small calcium-binding mitochondrial carrier protein 2, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 25, Solute carrier family 25 member 25, solute carrier family 25, member 25
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 114789
• Target Species: Human, Mouse, Rat
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SLC25A25
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LRLVFKSLDKKNDGRIDAQEIMQSLRDLGVKISEQQAEKILKSMDKNGTMTIDWNEWRDYHLLHPVENIPEIILYWKHSTIFDVGENLT
• Quantity: 25 μL
• Primary or Secondary: Primary
• Test Specificity: Specificity of human SLC25A25 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only