Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC25A39 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$517.59
Specifications
| Antigen | SLC25A39 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP159600
![]() |
Novus Biologicals
NBP159600 |
100 μL |
Each for $517.59
|
|
|||||
NBP15960020
![]() |
Novus Biologicals
NBP15960020UL |
20 μL | N/A | N/A | N/A | ||||
Description
SLC25A39 Polyclonal specifically detects SLC25A39 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SLC25A39 | |
| Polyclonal | |
| Rabbit | |
| Q9BZJ4 | |
| 51629 | |
| Synthetic peptides corresponding to SLC25A39(solute carrier family 25, member 39) The peptide sequence was selected from the C terminal of SLC25A39 (NP_057100). Peptide sequence RVNPLHVDSTWLLLRRIRAESGTKGLFAGFLPRIIKAAPSCAIMISTYEF. | |
| Primary |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| CGI69, CGI-69, FLJ22407, solute carrier family 25 member 39, solute carrier family 25, member 39 | |
| SLC25A39 | |
| IgG | |
| 39 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title