Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC25A45 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP325142
Description
SLC25A45 Polyclonal antibody specifically detects SLC25A45 in Human samples. It is validated for Western Blot, Immunocytochemistry/ ImmunofluorescenceSpecifications
SLC25A45 | |
Polyclonal | |
Western Blot 0.04-0.4 μg/mL, Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL | |
solute carrier family 25 member 45, solute carrier family 25, member 45 | |
This antibody has been engineered to specifically recognize the recombinant protein SLC25A45 using the following amino acid sequence: FDLIKVRLQNQTEPRAQPGSPPPRYQGPVHCAASIFREEGPRGLFRGAWALTLRDTPTVGIYFITYEGLCRQYTPEGQN | |
100 μL | |
Primary | |
Human | |
Purified |
Western Blot, Immunocytochemistry | |
Unconjugated | |
PBS, pH 7.2, 40% glycerol | |
Rabbit | |
Affinity purified | |
RUO | |
283130 | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction