Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC25A6 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159555
Description
SLC25A6 Polyclonal specifically detects SLC25A6 in Human samples. It is validated for Western Blot.Specifications
| SLC25A6 | |
| Polyclonal | |
| Unconjugated | |
| PBS, 2% Sucrose with 0.09% Sodium Azide | |
| Adenine nucleotide translocator 3, ADP, ADP/ATP translocase 3, ADP/ATP translocator of liver, ANT 2, ANT 3, ANT3AAC3, ANT3Y, ATP carrier protein, ATP carrier protein 3, ATP carrier protein, isoform T2, ATP carrier protein, liver, MGC17525, solute carrier family 25 (mitochondrial carrier; adenine nucleotidetranslocator), member 6, Solute carrier family 25 member 6 | |
| Rabbit | |
| Affinity purified | |
| RUO | |
| 293 | |
| Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
| Western Blot | |
| 0.5 mg/ml | |
| Western Blot 1.0 ug/ml | |
| Q6QRN9 | |
| SLC25A6 | |
| Synthetic peptides corresponding to SLC25A6(solute carrier family 25 (mitochondrial carrier; adenine nucleotide translocator), member 6) The peptide sequence was selected from the N terminal of SLC25A6. Peptide sequence LQVQHASKQIAADKQYKGIVDCIVRIPKEQGVLSFWRGNLANVIRYFPTQ The peptide sequence for this immunogen was taken from within the described region. | |
| 100 μL | |
| Primary | |
| Expected identity based on immunogen sequence: Chicken: 100%; Canine: 100%; Human: 100%; Sheep: 100%; Zebrafish: 92%. | |
| Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Goat, Rabbit, Sheep, Zebrafish | |
| IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction