SLC26A1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication

Supplier:  Novus Biologicals NBP18489725UL

Catalog No. NB432447

Description

SLC26A1 Polyclonal specifically detects SLC26A1 in Human, Rat samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SLC26A1
• Classification: Polyclonal
• Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:1000 - 1:2500
• Gene Alias: EDM4, SAT1, SAT-1sulfate anion transporter 1, solute carrier family 26 (sulfate transporter), member 1, Solute carrier family 26 member 1, sulfate anion tranporter AT1, sulfate transporter, sulfate/anion transporter SAT-1 protein
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 10861
• Target Species: Human, Rat
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: SLC26A1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:DTAFYEDATEFEGLVPEPGVRVFRFGGPLYYANKDFFLRSLYSLTGLDAGCMAARRKEGGSETGVGEGGP
• Quantity: 25ul
• Primary or Secondary: Primary
• Test Specificity: Specificity of human SLC26A1 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only