Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC26A10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | SLC26A10 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
SLC26A10 Polyclonal specifically detects SLC26A10 in Human samples. It is validated for Western Blot.Specifications
SLC26A10 | |
Polyclonal | |
Rabbit | |
Human | |
solute carrier family 26, member 10 | |
SLC26A10 | |
IgG |
Western Blot | |
Unconjugated | |
RUO | |
NP_597996 | |
65012 | |
Synthetic peptide directed towards the N terminal of human SLC26A10. Peptide sequence MRLDLASLMSAPKSLGSAFKSWRLDKAPSPQHTFPSTSIPGMAFALLASV. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title