Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC26A10 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

$436.00

Specifications

Antigen SLC26A10
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 1
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP180393
View Documents
Novus Biologicals
NBP180393
100 μL
Each of 1 for $436.00
Add to cart
 
Description

Description

SLC26A10 Polyclonal specifically detects SLC26A10 in Human samples. It is validated for Western Blot.
Specifications

Specifications

SLC26A10
Polyclonal
Rabbit
Human
solute carrier family 26, member 10
SLC26A10
IgG
Affinity Purified
Western Blot
Unconjugated
RUO
NP_597996
65012
Synthetic peptide directed towards the N terminal of human SLC26A10. Peptide sequence MRLDLASLMSAPKSLGSAFKSWRLDKAPSPQHTFPSTSIPGMAFALLASV.
Primary
Store at -20C. Avoid freeze-thaw cycles.
SDS
Product Certifications
Provide Content Correction

We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit