Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC26A10 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
| Antigen | SLC26A10 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180393
|
Novus Biologicals
NBP180393 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
SLC26A10 Polyclonal specifically detects SLC26A10 in Human samples. It is validated for Western Blot.Specifications
| SLC26A10 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| solute carrier family 26, member 10 | |
| SLC26A10 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_597996 | |
| 65012 | |
| Synthetic peptide directed towards the N terminal of human SLC26A10. Peptide sequence MRLDLASLMSAPKSLGSAFKSWRLDKAPSPQHTFPSTSIPGMAFALLASV. | |
| Primary |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title