SLC26A5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159791

Catalog No. NBP159791

Description

SLC26A5 Polyclonal specifically detects SLC26A5 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: SLC26A5
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: DFNB61PRESprestin (motor protein), MGC118886, MGC118887, MGC118888, MGC118889, prestin, Solute carrier family 26 member 5, solute carrier family 26, member 5 (prestin)
• Host Species: Rabbit
• Molecular Weight of Antigen: 81 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 100μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
• Concentration: 1 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Immunohistochemistry 1:10-1:500, Immunohistochemistry-Paraffin 1:10-1:500
• Gene Accession No.: P58743
• Gene Symbols: SLC26A5
• Immunogen: Synthetic peptides corresponding to SLC26A5(solute carrier family 26, member 5 (prestin)) The peptide sequence was selected from the middle region of SLC26A5. Peptide sequence FSVTISMAKTLANKHGYQVDGNQELIALGLCNSIGSLFQTFSISCSLSRS.
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Gene ID (Entrez): 375611
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Form: Purified

For Research Use Only