Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC26A9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 1 publication
Supplier: Novus Biologicals NBP23042525UL
Description
SLC26A9 Polyclonal specifically detects SLC26A9 in Human, Hamster samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
SLC26A9 | |
Polyclonal | |
Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin 1:20 - 1:50 | |
Q7LBE3 | |
SLC26A9 | |
This antibody was developed against a recombinant protein corresponding to amino acids: MSQPRPRYVVDRAAYSLTLFDDEFEKKDRTYPVGEKLRNAFRC | |
25ul | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
Anion transporter/exchanger protein 9, anion transporter/exchanger-9, solute carrier family 26 member 9, solute carrier family 26, member 9 | |
Rabbit | |
Affinity Purified | |
RUO | |
115019 | |
Human, Hamster | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction