Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC28A2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP23876325UL
Description
SLC28A2 Polyclonal specifically detects SLC28A2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
SLC28A2 | |
Polyclonal | |
Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
O43868 | |
SLC28A2 | |
This antibody was developed against a recombinant protein corresponding to amino acids: GAEADCVSFPNTSFTNRTYETYMCCRGLFQSTSLNGTNPPSFSGPWEDKEFSAMALTNCCGFYNNTVCA | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at-20°C long term. Avoid freeze/thaw cycles. |
Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
CNT2SPNT, Concentrative nucleoside transporter 2, FLJ21468, HCNT2, HsT17153, MGC138252, Na(+)/nucleoside cotransporter 2, sodium/nucleoside cotransporter 2, Sodium/purine nucleoside co-transporter, Sodium-coupled nucleoside transporter 2, solute carrier family 28 (sodium-coupled nucleoside transporter), member 2, Solute carrier family 28 member 2, SPNT1CNT 2 | |
Rabbit | |
Affinity Purified | |
RUO | |
9153 | |
Human | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction