SLC34A1 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP31779225UL

Catalog No. NB159615

Description

SLC34A1 Polyclonal antibody specifically detects SLC34A1 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: SLC34A1
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000
• Gene Alias: FRTS2, Na(+)/Pi cotransporter 2A, Na(+)-dependent phosphate cotransporter 2A, NaPi-2a, NaPi-3, NPT2NPHLOP1, NPTIIa, renal sodium-dependent phosphate transporter, SLC11, SLC17A2Na+-phosphate cotransporter type II, sodium/phosphate co-transporter, Sodium/phosphate cotransporter 2A, sodium-dependent phosphate transport protein 2A, Sodium-phosphate transport protein 2A, solute carrier family 17 (sodium phosphate), member 2, solute carrier family 34 (sodium phosphate), member 1, Solute carrier family 34 member 1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KLIIQLDESVITSIATGDESLRNHSLIQIWCHPDSLQAPTSMSRAEANSSQTLGNATMEKCNHIFVDTGLP
• Quantity: 25 μg
• Research Discipline: Endocrinology, Signal Transduction
• Gene ID (Entrez): 6569
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified