Learn More
Description
Specifications
Specifications
| Antigen | SLC34A1 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Immunohistochemistry 1:500 - 1:1000, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Formulation | PBS, pH 7.2, 40% glycerol |
| Gene Alias | FRTS2, Na(+)/Pi cotransporter 2A, Na(+)-dependent phosphate cotransporter 2A, NaPi-2a, NaPi-3, NPT2NPHLOP1, NPTIIa, renal sodium-dependent phosphate transporter, SLC11, SLC17A2Na+-phosphate cotransporter type II, sodium/phosphate co-transporter, Sodium/phosphate cotransporter 2A, sodium-dependent phosphate transport protein 2A, Sodium-phosphate transport protein 2A, solute carrier family 17 (sodium phosphate), member 2, solute carrier family 34 (sodium phosphate), member 1, Solute carrier family 34 member 1 |
| Host Species | Rabbit |
| Immunogen | This antibody was developed against Recombinant Protein corresponding to amino acids: KLIIQLDESVITSIATGDESLRNHSLIQIWCHPDSLQAPTSMSRAEANSSQTLGNATMEKCNHIFVDTGLP |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
