SLC34A3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179976

Catalog No. NBP179976

Description

SLC34A3 Polyclonal specifically detects SLC34A3 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SLC34A3
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Na(+)/Pi cotransporter 2C, Na(+)-dependent phosphate cotransporter 2C, naPi-2c, sodium-phosphate transport protein 2C, solute carrier family 34 (sodium phosphate), member 3
• Host Species: Rabbit
• Molecular Weight of Antigen: 63 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_543153
• Gene Symbols: SLC34A3
• Immunogen: Synthetic peptide directed towards the middle region of human SLC34A3. Peptide sequence GDRDEFQRAFSGSAVHGIFNWLTVLVLLPLESATALLERLSELALGAASL.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 142680
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig
• Isotype: IgG

For Research Use Only