Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC34A3 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP179976
Description
SLC34A3 Polyclonal specifically detects SLC34A3 in Human samples. It is validated for Western Blot.Specifications
SLC34A3 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
Na(+)/Pi cotransporter 2C, Na(+)-dependent phosphate cotransporter 2C, naPi-2c, sodium-phosphate transport protein 2C, solute carrier family 34 (sodium phosphate), member 3 | |
Rabbit | |
63 kDa | |
100 μL | |
Primary | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
NP_543153 | |
SLC34A3 | |
Synthetic peptide directed towards the middle region of human SLC34A3. Peptide sequence GDRDEFQRAFSGSAVHGIFNWLTVLVLLPLESATALLERLSELALGAASL. | |
Affinity purified | |
RUO | |
142680 | |
Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig | |
IgG |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction