Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC35A5 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP25824025UL
Description
SLC35A5 Polyclonal specifically detects SLC35A5 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
SLC35A5 | |
Polyclonal | |
Immunocytochemistry/Immunofluorescence 1-4 μg/mL | |
DKFZp434E102, FLJ11130, FLJ20730, FLJ25973, probable UDP-sugar transporter protein SLC35A5, Solute carrier family 35 member A5, solute carrier family 35, member A5 | |
Rabbit | |
Affinity Purified | |
RUO | |
55032 | |
Human | |
IgG |
Immunocytochemistry, Immunofluorescence | |
Unconjugated | |
PBS (pH 7.2), 40% Glycerol with 0.02% Sodium Azide | |
SLC35A5 | |
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KPQVPEYAPRQERIRDLSGNLWERSSGDGEELERLTKPKSDESDEDTF | |
25 μL | |
Primary | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction