SLC38A2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP325144

Catalog No. NB301308

Description

SLC38A2 Polyclonal antibody specifically detects SLC38A2 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

• Antigen: SLC38A2
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
• Gene Alias: Amino acid transporter A2, ata2, ATA2System A transporter 1, KIAA1382System N amino acid transporter 2, pro1068, Protein 40-9-1, sat2, SAT2PRO1068, snat2, SNAT2amino acid transporter 2, sodium-coupled neutral amino acid transporter 2, Solute carrier family 38 member 2, solute carrier family 38, member 2, System A amino acid transporter 2
• Immunogen: This antibody has been engineered to specifically recognize the recombinant protein SLC38A2 using the following amino acid sequence: PCPVEAALIINETINTTLTQPTALVPALSHNVTENDSCRPHYFI
• Quantity: 100 μL
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified

• Applications: Immunocytochemistry
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, 40% glycerol
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 54407
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
• Isotype: IgG