Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC38A3 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

$382.00 - $610.00

Specifications

Antigen SLC38A3
Applications Immunocytochemistry, Immunofluorescence
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP258073
SDP
View Documents
Novus Biologicals
NBP258073
100 μL
Each for $610.00
Only null left
Add to Cart
 
NB393629
SDP
View Documents
Novus Biologicals
NBP25807325UL
25 μL
Each for $382.00
Only null left
Add to Cart
 
Description

Description

SLC38A3 Polyclonal specifically detects SLC38A3 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.
Specifications

Specifications

SLC38A3
Polyclonal
Rabbit
Human
10991
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KFHVPCPLPPNFNNTTGNFSHVEIVKEKVQLQVEPEASAFCTPSYFTLNSQT
Primary
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Immunocytochemistry, Immunofluorescence
Unconjugated
RUO
G17sodium-coupled neutral amino acid transporter 3, Na(+)-coupled neutral amino acid transporter 3, NAT1, N-system amino acid transporter 1, SN1system N1 Na+ and H+-coupled glutamine transporter, SNAT3, Solute carrier family 38 member 3, solute carrier family 38, member 3, System N amino acid transporter 1
SLC38A3
IgG
Affinity Purified
Videos
SDS
Documents

Documents

Product Certifications

For Research Use Only

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.