SLC38A9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Supplier:  Novus Biologicals NBP169235

Catalog No. NBP169235

Description

SLC38A9 Polyclonal specifically detects SLC38A9 in Human samples. It is validated for Western Blot, Knockout Validated.

Specifications

• Antigen: SLC38A9
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ46104, FLJ90709, MGC120544, putative sodium-coupled neutral amino acid transporter 9, solute carrier family 38, member 9
• Host Species: Rabbit
• Molecular Weight of Antigen: 64 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: This antibody recognizes multiple isoforms
• Target Species: Human, Mouse, Rat, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot, Immunoassay
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml, Knockout Validated
• Gene Accession No.: Q8NBW4
• Gene Symbols: SLC38A9
• Immunogen: Synthetic peptides corresponding to FLJ90709 The peptide sequence was selected from the middle region of FLJ90709. Peptide sequence VLMSNFLFNTGKFIFNFIHHINDTDTILSTNNSNPVICPSAGSGGHPDNS.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 153129
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only