Learn More
Description
Specifications
Specifications
| Antigen | SLC39A10 |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Dilution | Western Blot 1.0 ug/ml |
| Formulation | PBS buffer, 2% sucrose |
| Gene Alias | DKFZp564L2123, DKFZp781L10106, FLJ90515, KIAA1265, LZT-Hs2, MGC126565, MGC138428, solute carrier family 39 (metal ion transporter), member 10, solute carrier family 39 (zinc transporter), member 10, Solute carrier family 39 member 10, zinc transporter ZIP10, ZIP10, ZIP-10, Zrt- and Irt-like protein 10 |
| Host Species | Rabbit |
| Immunogen | The immunogen is a synthetic peptide directed towards the N-terminal region of human SLC39A10 (NP_001120729.1). Peptide sequence EHCIRMFKHYKQQRGKQKWFMKQNTEESTIGRKLSDHKLNNTPDSDWLQL |
| Purification Method | Affinity purified |
| Show More |
By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.
