Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. SLC39A12 Antibody, Novus Biologicals™

SLC39A12 Antibody, Novus Biologicals™
SDP

Catalog No. p-7108545 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
20 μL
100 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP162528 100 μL
NBP16252820 20 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP162528 Supplier Novus Biologicals Supplier No. NBP162528
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

SLC39A12 Polyclonal specifically detects SLC39A12 in Human samples. It is validated for Western Blot.

Specifications

Antigen SLC39A12
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q504Y0-3
Gene Alias bA570F3.1, FLJ30499, LIV-1 subfamily of ZIP zinc transporter 8, LZT-Hs8, MGC43205, MGC51099, solute carrier family 39 (metal ion transporter), member 12, solute carrier family 39 (zinc transporter), member 12, Solute carrier family 39 member 12, zinc transporter ZIP12, ZIP12, ZIP-12, Zrt- and Irt-like protein 12
Gene Symbols SLC39A12
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SLC39A12(solute carrier family 39 (zinc transporter), member 12) The peptide sequence was selected from the N terminal of SLC39A12. Peptide sequence MCFRTKLSVSWVPLFLLLSRVFSTETDKPSAQDSRSRGSSGQPADLLQVL.
Molecular Weight of Antigen 73 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 221074
Test Specificity Equine: 85%; Bovine: 77%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Bovine, Equine
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.