Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC45A3/Prostein Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | SLC45A3/Prostein |
---|---|
Concentration | 0.2mg/mL |
Dilution | Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 |
Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Description
SLC45A3/Prostein Polyclonal specifically detects SLC45A3/Prostein in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
SLC45A3/Prostein | |
Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50-1:200 | |
Polyclonal | |
Rabbit | |
Human | |
IPCA-2, IPCA-6, IPCA-8, PCANAP6IPCA6, PCANAP8, prostate cancer associated protein 2, prostate cancer associated protein 6, prostate cancer associated protein 8, prostate cancer-associated gene 2, prostate cancer-associated gene 6, prostate cancer-associated gene 8, Prostate cancer-associated protein 6, Prostein, PRSTPCANAP2, solute carrier family 45 member 3, solute carrier family 45, member 3 | |
SLC45A3 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
0.2mg/mL | |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
85414 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:PKYRGDTGGASSEDSLMTSFLPGPKPGAPFPNGHVGAGGSGLLPPPPALCGASACDVSVRVVVGEP | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title