Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC5A5/Sodium Iodide Symporter Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$382.00 - $646.00
Specifications
| Antigen | SLC5A5/Sodium Iodide Symporter |
|---|---|
| Dilution | Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 |
| Applications | Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
SLC5A5/Sodium Iodide Symporter Polyclonal specifically detects SLC5A5/Sodium Iodide Symporter in Human, Rat samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| SLC5A5/Sodium Iodide Symporter | |
| Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
| Na(+)/I(-) cotransporter, Na(+)/I(-) symporter, NISNa(+)/I(-)-symporter, sodium/iodide cotransporter, Sodium-iodide symporter, solute carrier family 5 (sodium iodide symporter), member 5, Solute carrier family 5 member 5, TDH1 | |
| SLC5A5 | |
| IgG | |
| Affinity Purified | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
| Immunohistochemistry, Immunohistochemistry-Paraffin 1:500 - 1:1000 | |
| Polyclonal | |
| Rabbit | |
| Human, Rat | |
| Q92911 | |
| 6528 | |
| This antibody was developed against a recombinant protein corresponding to amino acids: PTKRSTLAPGLLWWDLARQTASVAPKEEVAILDDNLVKGPEELPTGNKKPPGFLPTNEDRLFFLGQKELEGAGSWTPCVGHDGGRDQQETNL | |
| Primary | |
| Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title