Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC5A8/SMCT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications
Supplier: Novus Biologicals NBP162527
Description
SLC5A8/SMCT1 Polyclonal specifically detects SLC5A8/SMCT1 in Human samples. It is validated for Western Blot.Specifications
SLC5A8/SMCT1 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
AITSolute carrier family 5 member 8, Apical iodide transporter, Electrogenic sodium monocarboxylate cotransporter, MGC125354, SMCTSMCT1, Sodium iodide-related cotransporter, sodium-coupled monocarboxylate transporter 1, solute carrier family 5 (iodide transporter), member 8 | |
Rabbit | |
66 kDa | |
100 μL | |
Primary | |
Mouse: 83%. | |
Human, Mouse, Rat, Rabbit | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
Q8N695 | |
SLC5A8 | |
Synthetic peptides corresponding to SLC5A8(solute carrier family 5 (iodide transporter), member 8) The peptide sequence was selected from the middle region of SLC5A8. Peptide sequence GILVPFANSIGALVGLMAGFAISLWVGIGAQIYPPLPERTLPLHLDIQGC. | |
Affinity purified | |
RUO | |
160728 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction