SLC5A8/SMCT1 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody has been used in 2 publications

Supplier:  Novus Biologicals NBP162527

Catalog No. NBP162527

Description

SLC5A8/SMCT1 Polyclonal specifically detects SLC5A8/SMCT1 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SLC5A8/SMCT1
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: AITSolute carrier family 5 member 8, Apical iodide transporter, Electrogenic sodium monocarboxylate cotransporter, MGC125354, SMCTSMCT1, Sodium iodide-related cotransporter, sodium-coupled monocarboxylate transporter 1, solute carrier family 5 (iodide transporter), member 8
• Host Species: Rabbit
• Molecular Weight of Antigen: 66 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Mouse: 83%.
• Target Species: Human, Mouse, Rat, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8N695
• Gene Symbols: SLC5A8
• Immunogen: Synthetic peptides corresponding to SLC5A8(solute carrier family 5 (iodide transporter), member 8) The peptide sequence was selected from the middle region of SLC5A8. Peptide sequence GILVPFANSIGALVGLMAGFAISLWVGIGAQIYPPLPERTLPLHLDIQGC.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 160728
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only