Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
SLC5A9 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP159873
Description
SLC5A9 Polyclonal specifically detects SLC5A9 in Human samples. It is validated for Western Blot.Specifications
SLC5A9 | |
Polyclonal | |
Unconjugated | |
PBS, 2% Sucrose with 0.09% Sodium Azide | |
SLC5A9 | |
Synthetic peptides corresponding to SLC5A9(solute carrier family 5 (sodium/glucose cotransporter), member 9) The peptide sequence was selected from the N terminal of SLC5A9. Peptide sequence MSKELAAMGPGASGDGVRTETAPHIALDSRVGLHAYDISVVVIYFVFVIA The peptide sequence for this immunogen was taken from within the described region. | |
100 μL | |
Primary | |
Expected identity based on immunogen sequence: Human: 100%; Equine: 85%. | |
Human, Equine | |
IgG |
Western Blot | |
0.5 mg/ml | |
Western Blot 1.0 ug/ml | |
hSGLT4, MGC132523, Na(+)/glucose cotransporter 4, SGLT4MGC132517, sodium/glucose cotransporter 4, solute carrier family 5 (sodium/glucose cotransporter), member 9, Solute carrier family 5 member 9 | |
Rabbit | |
Affinity purified | |
RUO | |
200010 | |
Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer. | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction