SLC6A14 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP159659

Catalog No. NBP159659

Description

SLC6A14 Polyclonal specifically detects SLC6A14 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: SLC6A14
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: Amino acid transporter ATB0+, amino acid transporter B0+, BMIQ11, OBX, sodium- and chloride-dependent neutral and basic amino acid transporter B(0+), solute carrier family 6 (amino acid transporter), member 14, solute carrier family 6 (neurotransmitter transporter), member 14, Solute carrier family 6 member 14
• Host Species: Rabbit
• Molecular Weight of Antigen: 72 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected to cross react based on sequence identity: Guinea Pig 86%.
• Target Species: Human, Mouse, Rat, Pig, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q9UN76
• Gene Symbols: SLC6A14
• Immunogen: Synthetic peptides corresponding to SLC6A14(solute carrier family 6 (amino acid transporter), member 14) The peptide sequence was selected from the middle region of SLC6A14. Peptide sequence VFAGFAIFSILGHMAHISGKEVSQVVKSGFDLAFIAYPEALAQLPGGPFW The peptide sequence for this immunogen was taken from within the described region.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 11254
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

For Research Use Only