SLC6A15 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP17419820UL

Catalog No. NBP17419820

Description

SLC6A15 Polyclonal specifically detects SLC6A15 in Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: SLC6A15
• Classification: Polyclonal
• Dilution: Western Blot 1:100-1:2000
• Gene Accession No.: Q8BG16
• Gene Symbols: SLC6A15
• Immunogen: Synthetic peptides corresponding to the middle region of Slc6a15. Immunizing peptide sequence VEDYRLVYDIIQKVKEEEFAVLHLNACQIEDELNKAVQGTGLAFIAFTEA.
• Quantity: 20 μL
• Primary or Secondary: Primary
• Target Species: Mouse
• Isotype: IgG

• Applications: Western Blot
• Conjugate: Unconjugated
• Formulation: PBS and 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: B0AT2, DKFZp761I0921, FLJ10316, homolog of rat orphan transporter v7-3, hv7-3, MGC87066, NTT73orphan sodium- and chloride-dependent neurotransmitter transporter NTT73, orphan transporter v7-3, SBAT1, Sodium- and chloride-dependent neurotransmitter transporter NTT73, sodium/chloride dependent neurotransmitter transporter Homo sapiens orphanneurotransmitter transporter NTT7, Sodium-coupled branched-chain amino-acid transporter 1, solute carrier family 6 (neurotransmitter transporter), member 15, solute carrier family 6 (neutral amino acid transporter), member 15, Solute carrier family 6 member 15, solute carrier family 6, member 15, Transporter v7-3, V7-3
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 55117
• Content And Storage: Store at -20C. Avoid freeze-thaw cycles.