Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

SLC6A15 Antibody, Novus Biologicals™
SDP

Catalog No. NBP159366 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP159366 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP159366 Supplier Novus Biologicals Supplier No. NBP159366
Add to Cart
Add to Cart

Rabbit Polyclonal Antibody

SLC6A15 Polyclonal specifically detects SLC6A15 in Human samples. It is validated for Western Blot.

Specifications

Antigen SLC6A15
Applications Western Blot
Classification Polyclonal
Concentration 0.5 mg/ml
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS, 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. Q9H2J7
Gene Alias B0AT2, DKFZp761I0921, FLJ10316, homolog of rat orphan transporter v7-3, hv7-3, MGC87066, NTT73orphan sodium- and chloride-dependent neurotransmitter transporter NTT73, orphan transporter v7-3, SBAT1, Sodium- and chloride-dependent neurotransmitter transporter NTT73, sodium/chloride dependent neurotransmitter transporter Homo sapiens orphanneurotransmitter transporter NTT7, Sodium-coupled branched-chain amino-acid transporter 1, solute carrier family 6 (neurotransmitter transporter), member 15, solute carrier family 6 (neutral amino acid transporter), member 15, Solute carrier family 6 member 15, solute carrier family 6, member 15, Transporter v7-3, V7-3
Gene Symbols SLC6A15
Host Species Rabbit
Immunogen Synthetic peptides corresponding to SLC6A15(solute carrier family 6, member 15) The peptide sequence was selected from the N terminal of SLC6A15. Peptide sequence DQCPLVKNASHTFVEPECEQSSATTYYWYREALNISSSISESGGLNWKMT.
Molecular Weight of Antigen 82 kDa
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 55117
Test Specificity Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Human: 100%; Rabbit: 100%; Mouse: 92%; Guinea pig: 85%; Chicken: 81%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
Content And Storage Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less

For Research Use Only

Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.