SLC6A2/NET/Noradrenaline transporter Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP160120

Catalog No. NBP160120

Description

SLC6A2/NET/Noradrenaline transporter Polyclonal antibody specifically detects SLC6A2/NET/Noradrenaline transporter in Human, Mouse samples. It is validated for Western Blot.

Specifications

• Antigen: SLC6A2/NET/Noradrenaline transporter
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: NAT1neurotransmitter transporter, NET, NET1sodium-dependent noradrenaline transporter, Norepinephrine transporter, SLC6A5, solute carrier family 6 (neurotransmitter transporter, noradrenalin), member 2, Solute carrier family 6 member 2, solute carrier family 6 member 5
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 6530
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: P23975
• Gene Symbols: SLC6A2
• Immunogen: Synthetic peptides corresponding to SLC6A2(solute carrier family 6 (neurotransmitter transporter, noradrenalin), member 2) The peptide sequence was selected from the middle region of SLC6A2. Peptide sequence STLSGSTFWAVVFFVMLLALGLDSSMGGMEAVITGLADDFQVLKRHRKLF The peptide sequence for this immunogen was taken from within the described region.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Bovine: 100%; Canine: 100%; Guinea pig: 100%; Equine: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Chicken: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit
• Isotype: IgG

For Research Use Only